Loading...
Statistics
Advertisement

Mathieu Drouet - Grande Plage — Home
www.grandeplage.photo/
projet photographique et phonographique par Mathieu Drouet

Grandeplage.photo

Advertisement
Conversion Technology Metas Server
Grandeplage.photo is hosted in United States / San Francisco . Grandeplage.photo uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Html5, Number of used javascripts: 3. First javascripts: Jquery.min.js, Api.eur.js, Theme.js, Number of used analytics tools: 0. Its server type is: openresty/1.5.8.1.

Technologies in use by Grandeplage.photo

Technology

Number of occurences: 4
  • CSS
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 3
  • jquery.min.js
  • api.eur.js
  • theme.js

Server Type

  • openresty/1.5.8.1

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Grandeplage.photo

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Multi-Domain/CN=sni51047.cloudflaressl.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Multi-Domain
      • CN: sni51047.cloudflaressl.com
    • hash: d5d5c714
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO ECC Domain Validation Secure Server CA 2
    • version: 2
    • serialNumber: 219545187250969774971428946371799970510
    • validFrom: 160818000000Z
    • validTo: 170219235959Z
    • validFrom_time_t: 1471478400
    • validTo_time_t: 1487548799
    • extensions:
      • authorityKeyIdentifier: keyid:40:09:61:67:F0:BC:83:71:4F:DE:12:08:2C:6F:D4:D4:2B:76:3D:96
      • subjectKeyIdentifier: 33:20:C4:85:36:58:75:E8:DB:94:59:93:19:FB:7E:B2:6D:73:0F:FF
      • keyUsage: Digital Signature
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca4.com/COMODOECCDomainValidationSecureServerCA2.crt OCSP - URI:http://ocsp.comodoca4.com
      • subjectAltName: DNS:sni51047.cloudflaressl.com, DNS:*.anextraleveladaykeepsthegirlaway.com, DNS:*.carloskrush.xyz, DNS:*.doedemure.co.uk, DNS:*.drable.com, DNS:*.grandeplage.photo, DNS:*.jeremiahrdfaggins.tk, DNS:*.lestantines.fr, DNS:*.lorenflring.tk, DNS:*.northgeorgiahighlandsseafoodfestival.com, DNS:*.pinturadecorativadigital.com, DNS:*.sacavin.fr, DNS:*.sushiestanoche.com, DNS:*.yolacouture.ca, DNS:*.yulandamachle.xyz, DNS:*.zhhrb.com, DNS:anextraleveladaykeepsthegirlaway.com, DNS:carloskrush.xyz, DNS:doedemure.co.uk, DNS:drable.com, DNS:grandeplage.photo, DNS:jeremiahrdfaggins.tk, DNS:lestantines.fr, DNS:lorenflring.tk, DNS:northgeorgiahighlandsseafoodfestival.com, DNS:pinturadecorativadigital.com, DNS:sacavin.fr, DNS:sushiestanoche.com, DNS:yolacouture.ca, DNS:yulandamachle.xyz, DNS:zhhrb.com

Meta - Grandeplage.photo

Number of occurences: 10
  • Name:
    Content: projet photographique et phonographique par Mathieu Drouet
  • Name: description
    Content: projet photographique et phonographique par Mathieu Drouet
  • Name: keywords
    Content: Hats, Tees, Albums, Prints, Books
  • Name: viewport
    Content: width=device-width,maximum-scale=1.0,user-scalable=no
  • Name: generator
    Content: Big Cartel
  • Name: author
    Content: Mathieu Drouet - Grande Plage
  • Name: referrer
    Content: origin
  • Name: twitter:card
    Content: summary_large_image
  • Name: twitter:title
    Content: Mathieu Drouet - Grande Plage
  • Name: twitter:description
    Content: projet photographique et phonographique par Mathieu Drouet

Server / Hosting

  • IP: 151.101.13.64
  • Latitude: 37.77
  • Longitude: -122.39
  • Country: United States
  • City: San Francisco

Rname

  • emma.ns.cloudflare.com
  • jeff.ns.cloudflare.com
  • spool.mail.gandi.net
  • fb.mail.gandi.net

Target

  • dns.cloudflare.com

HTTP Header Response

HTTP/1.1 200 OK Server: openresty/1.5.8.1 Content-Type: text/html; charset=utf-8 Status: 200 OK X-Frame-Options: SAMEORIGIN X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff ETag: "9e72eb4c145746ce72e488bf04532c33" Cache-Control: public Set-Cookie: _storefront_session=SEF5MzJMRUwxd0pkUkh5MWUwOVR1Qmg5cmNOOEszUkhrQzhtVlNqdzJhU3VzenZ3YVpSb3djZ2xiZkVoZERZM1JEcGU1WjVYbitKd05JYS90ck5ETzBiSkR5Wm9HSCtOYnZzWmIyMXQ1b2NpVmUxbWowMDdEV0cwNlBScTBrSU16UWxwajg1MGZHU3ErczY0NTRQMEdTMGNhQjFISHlYYTFPdSswenJ3MzBJVHp6S3ZoZkxpWG5ndUJqR1JDWUVtLS1tQU1OTlFUbDE1SlB6VE9sMGdNS2xRPT0%3D--065fab5d9bcbd0060273e4867c288178c4853a8f; path=/; HttpOnly X-Request-Id: 4066d2bd-a53b-429a-b870-8541db029c9b X-Runtime: 39.7 Accept-Ranges: bytes Date: Wed, 24 Aug 2016 00:21:50 GMT Age: 0 X-Served-By: cache-ams4145-AMS X-Cache: MISS X-Cache-Hits: 0 X-Timer: S1471998110.749443,VS0,VE194 Vary: Accept-Encoding X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Transfer-Encoding: chunked Via: 1.1 varnish, 1.1 s_wx1123 (squid/3.5.16) Connection: keep-alive

DNS

host: grandeplage.photo
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.28.25.34
host: grandeplage.photo
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 104.28.24.34
host: grandeplage.photo
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: emma.ns.cloudflare.com
host: grandeplage.photo
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: jeff.ns.cloudflare.com
host: grandeplage.photo
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: emma.ns.cloudflare.com
  5. rname: dns.cloudflare.com
  6. serial: 2018443590
  7. refresh: 10000
  8. retry: 2400
  9. expire: 604800
  10. minimum-ttl: 3600
host: grandeplage.photo
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 10
  5. target: spool.mail.gandi.net
host: grandeplage.photo
  1. class: IN
  2. ttl: 300
  3. type: MX
  4. pri: 50
  5. target: fb.mail.gandi.net
host: grandeplage.photo
  1. class: IN
  2. ttl: 300
  3. type: AAAA
  4. ipv6: 2400:cb00:2048:1::681c:1822
host: grandeplage.photo
  1. class: IN
  2. ttl: 300
  3. type: AAAA
  4. ipv6: 2400:cb00:2048:1::681c:1922

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.randeplage.photo, www.gsrandeplage.photo, www.srandeplage.photo, www.gxrandeplage.photo, www.xrandeplage.photo, www.gyrandeplage.photo, www.yrandeplage.photo, www.ghrandeplage.photo, www.hrandeplage.photo, www.gnrandeplage.photo, www.nrandeplage.photo, www.gcrandeplage.photo, www.crandeplage.photo, www.gdrandeplage.photo, www.drandeplage.photo, www.gerandeplage.photo, www.erandeplage.photo, www.grrandeplage.photo, www.rrandeplage.photo, www.gtrandeplage.photo, www.trandeplage.photo, www.gbrandeplage.photo, www.brandeplage.photo, www.gvrandeplage.photo, www.vrandeplage.photo, www.gandeplage.photo, www.griandeplage.photo, www.giandeplage.photo, www.groandeplage.photo, www.goandeplage.photo, www.grlandeplage.photo, www.glandeplage.photo, www.grlandeplage.photo, www.glandeplage.photo, www.gr.andeplage.photo, www.g.andeplage.photo, www.grndeplage.photo, www.graondeplage.photo, www.grondeplage.photo, www.grapndeplage.photo, www.grpndeplage.photo, www.gra9ndeplage.photo, www.gr9ndeplage.photo, www.grandeplage.photo, www.grndeplage.photo, www.graindeplage.photo, www.grindeplage.photo, www.graundeplage.photo, www.grundeplage.photo, www.gradeplage.photo, www.granndeplage.photo, www.grandeplage.photo, www.granhdeplage.photo, www.grahdeplage.photo, www.granjdeplage.photo, www.grajdeplage.photo, www.grankdeplage.photo, www.grakdeplage.photo, www.granldeplage.photo, www.graldeplage.photo, www.gran deplage.photo, www.gra deplage.photo, www.graneplage.photo, www.grandteplage.photo, www.granteplage.photo, www.grandgeplage.photo, www.grangeplage.photo, www.grandbeplage.photo, www.granbeplage.photo, www.grandxeplage.photo, www.granxeplage.photo, www.grandseplage.photo, www.granseplage.photo, www.grandfeplage.photo, www.granfeplage.photo, www.grandveplage.photo, www.granveplage.photo, www.grandyeplage.photo, www.granyeplage.photo, www.grandzeplage.photo, www.granzeplage.photo, www.grandaeplage.photo, www.granaeplage.photo, www.grandeeplage.photo, www.graneeplage.photo, www.grandreplage.photo, www.granreplage.photo, www.grandplage.photo, www.grandexplage.photo, www.grandxplage.photo, www.grandesplage.photo, www.grandsplage.photo, www.grandewplage.photo, www.grandwplage.photo, www.granderplage.photo, www.grandrplage.photo, www.grandefplage.photo, www.grandfplage.photo, www.grandevplage.photo, www.grandvplage.photo, www.grandecplage.photo, www.grandcplage.photo, www.grandeqplage.photo, www.grandqplage.photo, www.grandeaplage.photo, www.grandaplage.photo, www.grandeyplage.photo, www.grandyplage.photo, www.grandelage.photo, www.grandepilage.photo, www.grandeilage.photo, www.grandepklage.photo, www.grandeklage.photo, www.grandepulage.photo, www.grandeulage.photo, www.grandepjlage.photo, www.grandejlage.photo, www.grandepllage.photo, www.grandellage.photo, www.grandepage.photo, www.grandepluage.photo, www.grandepuage.photo, www.grandepl8age.photo, www.grandep8age.photo, www.grandepl9age.photo, www.grandep9age.photo, www.grandepljage.photo, www.grandepjage.photo, www.grandepl0age.photo, www.grandep0age.photo, www.grandeplmage.photo, www.grandepmage.photo, www.grandeplpage.photo, www.grandeppage.photo, www.grandeploage.photo, www.grandepoage.photo, www.grandeplge.photo, www.grandeplaoge.photo, www.grandeploge.photo, www.grandeplapge.photo, www.grandeplpge.photo, www.grandepla9ge.photo, www.grandepl9ge.photo, www.grandeplage.photo, www.grandeplge.photo, www.grandeplaige.photo, www.grandeplige.photo, www.grandeplauge.photo, www.grandepluge.photo, www.grandeplae.photo, www.grandeplagse.photo, www.grandeplase.photo, www.grandeplagxe.photo, www.grandeplaxe.photo, www.grandeplagye.photo, www.grandeplaye.photo, www.grandeplaghe.photo, www.grandeplahe.photo, www.grandeplagne.photo, www.grandeplane.photo, www.grandeplagce.photo, www.grandeplace.photo, www.grandeplagde.photo, www.grandeplade.photo, www.grandeplagee.photo, www.grandeplaee.photo, www.grandeplagre.photo, www.grandeplare.photo, www.grandeplagte.photo, www.grandeplate.photo, www.grandeplagbe.photo, www.grandeplabe.photo, www.grandeplagve.photo, www.grandeplave.photo,

Other websites we recently analyzed

  1. شركت دارویی، آرایشی و بهداشتی مینو - تولید انواع محصولات دارویی و آرایشی و بهداشتی
    شركت دارویی، آرایشی و بهداشتی مینو - صفحه اصلی - شرکت دارویی آرایشی و بهداشتی مینو تولیدکننده انواع دارو, ویتامین و مکملهای غذایی و نیز محصولات آرایشی و بهداشتی با دو برند مکث و رزایران می باشد
    Iran, Islamic Republic of - 79.175.170.156
    G Analytics ID: UA-74250114-1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Font Awesome, Google Font API, Html, Javascript, jQuery, jQuery Cookie, Modernizr.js, Google Analytics, DotNetNuke
    Number of Javascript: 36
    Number of meta tags: 5
  2. value-side.com
    Scottsdale (United States) - 184.168.221.43
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  3. Eric Menard's Complete Martial Arts Academy - South Nashua, New Hampshire
    Enfield (United States) - 173.14.170.36
    Server software: Apache
    Technology: CSS, Html, Php
    Number of meta tags: 1
  4. visionaryinfo.com
    New York (United States) - 69.172.201.153
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  5. GÜMA Wohnmobile & Caravans – GÜMA Caravan-Motorcaravan KG
    Ihr Experte für Wohnmobile und Wohnwagen in Mannheim. Entdecken Sie unsere große Auswahl an ständig über 180 neuen und gebrauchten Reisemobilen und Caravans.
    Germany - 37.200.100.4
    G Analytics ID: UA-55329748-1
    Server software: Apache/2.4.20
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 2
    Number of meta tags: 3
  6. stonebath.com
    Dallas (United States) - 75.126.104.243
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  7. www.daisywell.it
    Arezzo (Italy) - 62.149.144.86
    Server software: squid/3.5.19
    Technology: CSS, Html
    Number of meta tags: 1
  8. 1194.pics
    New York (United States) - 199.59.243.120
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, Html, Html5, Javascript
    Number of meta tags: 2
  9. 鑫泽智慧-智能热力电站装备制造商及节能整体解决方案服务商
    Hangzhou (China) - 114.55.49.179
    Server software:
    Technology: CSS, Html, Html5, Javascript, jQuery Validate, jQuery UI
    Number of Javascript: 12
    Number of meta tags: 8
  10. Sie sehen hier eine soeben freigeschaltete Homepage
    Berlin (Germany) - 81.169.145.74
    Server software: Apache/2.2.31 (Unix)
    Technology: Html
    Number of meta tags: 2

Check Other Websites